PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC028057.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 121aa    MW: 13426.6 Da    PI: 10.131
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC028057.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.41.9e-18840133
          GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33
                  C+ C+tt Tp+WR gp g+++LCnaCG++yrk+
  EcC028057.20  8 CVECRTTRTPMWRGGPAGPRSLCNACGIKYRKR 40
                  ********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.5E-11267IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.255238IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-12541No hitNo description
Gene3DG3DSA:3.30.50.108.2E-15641IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.51E-10843No hitNo description
PROSITE patternPS003440833IPR000679Zinc finger, GATA-type
PfamPF003203.1E-16840IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MKVVDRHCVE CRTTRTPMWR GGPAGPRSLC NACGIKYRKR SRGLLGADKK CFKNTPAAAA  60
ATNNDRIERG LAEMVKQGLV NPAAKTESEK NRAMTGEMRW RLREEEEAAI LLMALSCDVF  120
G
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069875.19e-77PREDICTED: GATA transcription factor 16-like
TrEMBLA0A059AWY81e-76A0A059AWY8_EUCGR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.11e-16GATA transcription factor 23